SCOP 1.75: Domain d1txqb1: 1txq B:192-255

Lineage for d1txqb1 (1txq B:192-255)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily)
   dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices

4. Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family)

5. Family a.245.1.1: EB1 dimerisation domain-like [140613] (1 protein)
   Pfam PF03271

6. Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140615] (6 PDB entries)
   Uniprot Q15691 189-249! Uniprot Q15691 189-254! Uniprot Q15691 190-248! Uniprot Q15691 191-254

8. Domain d1txqb1: 1txq B:192-255 [119389]
   Other proteins in same PDB: d1txqa1

Details for d1txqb1

PDB Entry: 1txq, 1.8 Å

PDB Description: Crystal structure of the EB1 C-terminal domain complexed with the CAP-Gly domain of p150Glued

PDB Compounds: (B:) Microtubule-associated protein RP/EB family member 1

SCOP Domain Sequences for d1txqb1:

Sequence; same for both SEQRES and ATOM records:

>d1txqb1 a.245.1.1 (B:192-255) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
eaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilyatde
gfvi

Timeline for d1txqb1:

• d1txqb1 first appeared in SCOP 1.73
  
• d1txqb1 appears in SCOPe 2.01
  
• d1txqb1 appears in the current release, SCOPe 2.08