Lineage for d1txqa1 (1txq A:25-98)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 797091Superfamily b.34.10: Cap-Gly domain [74924] (1 family) (S)
  5. 797092Family b.34.10.1: Cap-Gly domain [74925] (10 proteins)
    Pfam PF01302
  6. 797116Protein Dynactin 1 [141234] (1 species)
  7. 797117Species Human (Homo sapiens) [TaxId:9606] [141235] (3 PDB entries)
    Uniprot Q14203 1-99! Uniprot Q14203 25-98
  8. 797122Domain d1txqa1: 1txq A:25-98 [119388]
    Other proteins in same PDB: d1txqb1

Details for d1txqa1

PDB Entry: 1txq (more details), 1.8 Å

PDB Description: Crystal structure of the EB1 C-terminal domain complexed with the CAP-Gly domain of p150Glued
PDB Compounds: (A:) Dynactin 1

SCOP Domain Sequences for d1txqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1txqa1 b.34.10.1 (A:25-98) Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]}
rplrvgsrvevigkghrgtvayvgatlfatgkwvgvildeakgkndgtvqgrkyftcdeg
hgifvrqsqiqvfe

SCOP Domain Coordinates for d1txqa1:

Click to download the PDB-style file with coordinates for d1txqa1.
(The format of our PDB-style files is described here.)

Timeline for d1txqa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1txqb1