SCOP 1.73: Domain d1txqa1: 1txq A:25-98

Lineage for d1txqa1 (1txq A:25-98)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.34: SH3-like barrel [50036] (18 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.10: Cap-Gly domain [74924] (1 family)

5. Family b.34.10.1: Cap-Gly domain [74925] (10 proteins)
   Pfam PF01302

6. Protein Dynactin 1 [141234] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141235] (2 PDB entries)

8. Domain d1txqa1: 1txq A:25-98 [119388]
   Other proteins in same PDB: d1txqb1

Details for d1txqa1

PDB Entry: 1txq, 1.8 Å

PDB Description: Crystal structure of the EB1 C-terminal domain complexed with the CAP-Gly domain of p150Glued

PDB Compounds: (A:) Dynactin 1

SCOP Domain Sequences for d1txqa1:

Sequence; same for both SEQRES and ATOM records:

>d1txqa1 b.34.10.1 (A:25-98) Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]}
rplrvgsrvevigkghrgtvayvgatlfatgkwvgvildeakgkndgtvqgrkyftcdeg
hgifvrqsqiqvfe

Timeline for d1txqa1:

• d1txqa1 is new in SCOP 1.73
  
• d1txqa1 appears in SCOP 1.75
  
• d1txqa1 appears in the current release, SCOPe 2.08