Lineage for d1txia_ (1txi A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. Protein automated matches [190059] (14 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187214] (165 PDB entries)
  8. Domain d1txia_: 1txi A: [119387]
    automated match to d1ie9a_
    complexed with tx5

Details for d1txia_

PDB Entry: 1txi (more details), 1.9 Å

PDB Description: crystal structure of the vdr ligand binding domain complexed to tx522
PDB Compounds: (A:) Vitamin D receptor

SCOPe Domain Sequences for d1txia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1txia_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlphl
adlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtcgn
qdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaa
lieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqpec
smkltplvlevfg

SCOPe Domain Coordinates for d1txia_ are not available.

Timeline for d1txia_: