SCOPe 2.08: Domain d1txia_: 1txi A:

Lineage for d1txia_ (1txi A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein automated matches [190059] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187214] (171 PDB entries)

8. Domain d1txia_: 1txi A: [119387]
   automated match to d1ie9a_
   complexed with tx5

Details for d1txia_

PDB Entry: 1txi, 1.9 Å

PDB Description: crystal structure of the vdr ligand binding domain complexed to tx522

PDB Compounds: (A:) Vitamin D receptor

SCOPe Domain Sequences for d1txia_:

Sequence; same for both SEQRES and ATOM records:

>d1txia_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlphl
adlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtcgn
qdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaa
lieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqpec
smkltplvlevfg

Timeline for d1txia_:

• d1txia_ first appeared in SCOP 1.73, called d1txia1
  
• d1txia_ appears in SCOPe 2.07