Lineage for d1txia_ (1txi A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009403Protein automated matches [190059] (14 species)
    not a true protein
  7. 2009425Species Human (Homo sapiens) [TaxId:9606] [187214] (142 PDB entries)
  8. 2009445Domain d1txia_: 1txi A: [119387]
    automated match to d1ie9a_
    complexed with tx5

Details for d1txia_

PDB Entry: 1txi (more details), 1.9 Å

PDB Description: Crystal structure of the vdr ligand binding domain complexed to TX522
PDB Compounds: (A:) Vitamin D receptor

SCOPe Domain Sequences for d1txia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1txia_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlphl
adlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtcgn
qdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaa
lieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqpec
smkltplvlevfg

SCOPe Domain Coordinates for d1txia_:

Click to download the PDB-style file with coordinates for d1txia_.
(The format of our PDB-style files is described here.)

Timeline for d1txia_: