Lineage for d1txfa1 (1txf A:5-116,A:119-252)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 710610Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 710611Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 710612Family c.94.1.1: Phosphate binding protein-like [53851] (35 proteins)
  6. 710786Protein Glutamate receptor ligand binding core [53881] (4 species)
  7. 710905Species Rat (Rattus norvegicus), GluR5 [TaxId:10116] [142802] (6 PDB entries)
  8. 710918Domain d1txfa1: 1txf A:5-116,A:119-252 [119386]
    complexed with glu

Details for d1txfa1

PDB Entry: 1txf (more details), 2.1 Å

PDB Description: crystal structure of the glur5 ligand binding core in complex with glutamate at 2.1 angstrom resolution
PDB Compounds: (A:) Glutamate receptor, ionotropic kainate 1

SCOP Domain Sequences for d1txfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1txfa1 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR5 [TaxId: 10116]}
tlivttileepyvmyrksdkplygndrfegycldllkelsnilgflydvklvpdgkygaq
ndkgewngmvkelidhradlavapltityvrekvidfskpfmtlgisilyrkXpidsadd
lakqtkieygavrdgstmtffkkskistyekmwafmssrqqsalvknsdegiqrvlttdy
allmestsieyvtqrncnltqigglidskgygvgtpigspyrdkitiailqlqeegklhm
mkekwwr

SCOP Domain Coordinates for d1txfa1:

Click to download the PDB-style file with coordinates for d1txfa1.
(The format of our PDB-style files is described here.)

Timeline for d1txfa1: