SCOPe 2.08: Domain d1txfa1: 1txf A:5-116,A:119-252

Lineage for d1txfa1 (1txf A:5-116,A:119-252)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Glutamate receptor ligand binding core [53881] (5 species)

7. Species Norway rat (Rattus norvegicus), GluR5 [TaxId:10116] [142802] (5 PDB entries)
   Uniprot P22756 429-546,667-799! Uniprot P22756 433-544,682-815

8. Domain d1txfa1: 1txf A:5-116,A:119-252 [119386]
   complexed with glu

Details for d1txfa1

PDB Entry: 1txf, 2.1 Å

PDB Description: crystal structure of the glur5 ligand binding core in complex with glutamate at 2.1 angstrom resolution

PDB Compounds: (A:) Glutamate receptor, ionotropic kainate 1

SCOPe Domain Sequences for d1txfa1:

Sequence; same for both SEQRES and ATOM records:

>d1txfa1 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR5 [TaxId: 10116]}
tlivttileepyvmyrksdkplygndrfegycldllkelsnilgflydvklvpdgkygaq
ndkgewngmvkelidhradlavapltityvrekvidfskpfmtlgisilyrkXpidsadd
lakqtkieygavrdgstmtffkkskistyekmwafmssrqqsalvknsdegiqrvlttdy
allmestsieyvtqrncnltqigglidskgygvgtpigspyrdkitiailqlqeegklhm
mkekwwr

Timeline for d1txfa1:

• d1txfa1 first appeared in SCOP 1.73
  
• d1txfa1 appears in SCOPe 2.07