![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins) |
![]() | Protein automated matches [190058] (11 species) not a true protein |
![]() | Species Pachyrhizus erosus [TaxId:109171] [186778] (2 PDB entries) |
![]() | Domain d1txca2: 1txc A:1-147 [119384] Other proteins in same PDB: d1txca3, d1txcb3 automated match to d1icxa_ complexed with 2an |
PDB Entry: 1txc (more details), 2.3 Å
SCOPe Domain Sequences for d1txca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1txca2 d.129.3.1 (A:1-147) automated matches {Pachyrhizus erosus [TaxId: 109171]} gvfvfrdetsssvapaklykaltkdsdtiaqkidgpiqsielvegnggvgtikkitaneg dktsfvlqkvdaideanlgydysivggtglpesleklsfetkvvagsgggsiskvtlkfh tkgdaplsdavrddalakgagffkaie
Timeline for d1txca2: