SCOPe 2.05: Domain d1tx9a1: 1tx9 A:7-144

Lineage for d1tx9a1 (1tx9 A:7-144)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.84: Scaffolding protein gpD of bacteriophage procapsid [48044] (1 superfamily)
   core: 6 helices; one central helix is surrounded by 5 others

4. Superfamily a.84.1: Scaffolding protein gpD of bacteriophage procapsid [48045] (1 family)
   automatically mapped to Pfam PF02925

5. Family a.84.1.1: Scaffolding protein gpD of bacteriophage procapsid [48046] (1 protein)

6. Protein Scaffolding protein gpD of bacteriophage procapsid [48047] (1 species)

7. Species Bacteriophage phi-X174 [TaxId:10847] [48048] (3 PDB entries)

8. Domain d1tx9a1: 1tx9 A:7-144 [119383]
   automatically matched to d1al04_

Details for d1tx9a1

PDB Entry: 1tx9, 3.31 Å

PDB Description: gpd prior to capsid assembly

PDB Compounds: (A:) Scaffolding protein D

SCOPe Domain Sequences for d1tx9a1:

Sequence; same for both SEQRES and ATOM records:

>d1tx9a1 a.84.1.1 (A:7-144) Scaffolding protein gpD of bacteriophage procapsid {Bacteriophage phi-X174 [TaxId: 10847]}
qsvrfqtalasikliqasavldlteddfdfltsnkvwiatdrsrarrcveacvygtldfv
gyprfpapvefiaaviayyvhpvniqtaclimegaefteniingverpvkaaelfaftlr
vragntdvltdaeenvrq

Timeline for d1tx9a1:

• d1tx9a1 first appeared in SCOP 1.73
  
• d1tx9a1 appears in SCOPe 2.04
  
• d1tx9a1 appears in SCOPe 2.06
  
• d1tx9a1 appears in the current release, SCOPe 2.08