SCOPe 2.05: Domain d1tx8a_: 1tx8 A:

Lineage for d1tx8a_ (1tx8 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (396 PDB entries)
   Uniprot P00760

8. Domain d1tx8a_: 1tx8 A: [119382]
   automated match to d1aq7__
   complexed with am4, ca

Details for d1tx8a_

PDB Entry: 1tx8, 1.7 Å

PDB Description: bovine trypsin complexed with amso

PDB Compounds: (A:) trypsinogen

SCOPe Domain Sequences for d1tx8a_:

Sequence; same for both SEQRES and ATOM records:

>d1tx8a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d1tx8a_:

• d1tx8a_ first appeared in SCOP 1.73, called d1tx8a1
  
• d1tx8a_ appears in SCOPe 2.04
  
• d1tx8a_ appears in SCOPe 2.06
  
• d1tx8a_ appears in the current release, SCOPe 2.08