![]() | Class g: Small proteins [56992] (94 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (2 families) ![]() |
![]() | Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins) |
![]() | Protein automated matches [192457] (4 species) not a true protein |
![]() | Species Barley (Hordeum vulgare) [TaxId:4513] [254905] (2 PDB entries) |
![]() | Domain d1tx6i1: 1tx6 I:65-125 [119379] Other proteins in same PDB: d1tx6a_, d1tx6b_, d1tx6c_, d1tx6d_ automated match to d1c2aa2 complexed with ca |
PDB Entry: 1tx6 (more details), 2.2 Å
SCOPe Domain Sequences for d1tx6i1:
Sequence, based on SEQRES records: (download)
>d1tx6i1 g.3.13.1 (I:65-125) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]} pweccdkaictrsnpptcrcvdevkkcaptcktclpsrsrpsrrvcidsyfgpvpprctp r
>d1tx6i1 g.3.13.1 (I:65-125) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]} pweccdkaictrsnpptcrcvdevkkcaptcktclrvcidsyfgpvpprctpr
Timeline for d1tx6i1: