![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (1 family) ![]() |
![]() | Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins) |
![]() | Protein Bowman-Birk inhibitor, BBI [57249] (8 species) duplication: consists of two sequence repeats each having this fold |
![]() | Species Barley (Hordeum vulgare) [TaxId:4513] [57254] (3 PDB entries) further duplication: consist of two BBI domains |
![]() | Domain d1tx6i1: 1tx6 I:64-122 [119379] Other proteins in same PDB: d1tx6a_, d1tx6b_, d1tx6c_, d1tx6d_ automatically matched to d1c2aa1 complexed with ca |
PDB Entry: 1tx6 (more details), 2.2 Å
SCOPe Domain Sequences for d1tx6i1:
Sequence, based on SEQRES records: (download)
>d1tx6i1 g.3.13.1 (I:64-122) Bowman-Birk inhibitor, BBI {Barley (Hordeum vulgare) [TaxId: 4513]} rpweccdkaictrsnpptcrcvdevkkcaptcktclpsrsrpsrrvcidsyfgpvpprc
>d1tx6i1 g.3.13.1 (I:64-122) Bowman-Birk inhibitor, BBI {Barley (Hordeum vulgare) [TaxId: 4513]} rpweccdkaictrsnpptcrcvdevkkcaptcktclrvcidsyfgpvpprc
Timeline for d1tx6i1: