Lineage for d1tx6i1 (1tx6 I:64-122)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1240201Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1241472Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (1 family) (S)
  5. 1241473Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins)
  6. 1241474Protein Bowman-Birk inhibitor, BBI [57249] (8 species)
    duplication: consists of two sequence repeats each having this fold
  7. 1241477Species Barley (Hordeum vulgare) [TaxId:4513] [57254] (3 PDB entries)
    further duplication: consist of two BBI domains
  8. 1241481Domain d1tx6i1: 1tx6 I:64-122 [119379]
    Other proteins in same PDB: d1tx6a_, d1tx6b_, d1tx6c_, d1tx6d_
    automatically matched to d1c2aa1
    complexed with ca

Details for d1tx6i1

PDB Entry: 1tx6 (more details), 2.2 Å

PDB Description: trypsin:BBI complex
PDB Compounds: (I:) Bowman-Birk type trypsin inhibitor

SCOPe Domain Sequences for d1tx6i1:

Sequence, based on SEQRES records: (download)

>d1tx6i1 g.3.13.1 (I:64-122) Bowman-Birk inhibitor, BBI {Barley (Hordeum vulgare) [TaxId: 4513]}
rpweccdkaictrsnpptcrcvdevkkcaptcktclpsrsrpsrrvcidsyfgpvpprc

Sequence, based on observed residues (ATOM records): (download)

>d1tx6i1 g.3.13.1 (I:64-122) Bowman-Birk inhibitor, BBI {Barley (Hordeum vulgare) [TaxId: 4513]}
rpweccdkaictrsnpptcrcvdevkkcaptcktclrvcidsyfgpvpprc

SCOPe Domain Coordinates for d1tx6i1:

Click to download the PDB-style file with coordinates for d1tx6i1.
(The format of our PDB-style files is described here.)

Timeline for d1tx6i1: