SCOP 1.75: Domain d1tx6i1: 1tx6 I:64-122

Lineage for d1tx6i1 (1tx6 I:64-122)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (1 family)

5. Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (1 protein)

6. Protein Bowman-Birk inhibitor, BBI [57249] (10 species)
   duplication: consists of two sequence repeats each having this fold

7. Species Barley (Hordeum vulgare) [TaxId:4513] [57254] (3 PDB entries)
   further duplication: consist of two BBI domains

8. Domain d1tx6i1: 1tx6 I:64-122 [119379]
   Other proteins in same PDB: d1tx6a1, d1tx6b1, d1tx6c1, d1tx6d1
   automatically matched to d1c2aa1
   complexed with ca

Details for d1tx6i1

PDB Entry: 1tx6, 2.2 Å

PDB Description: trypsin:BBI complex

PDB Compounds: (I:) Bowman-Birk type trypsin inhibitor

SCOP Domain Sequences for d1tx6i1:

Sequence, based on SEQRES records:

>d1tx6i1 g.3.13.1 (I:64-122) Bowman-Birk inhibitor, BBI {Barley (Hordeum vulgare) [TaxId: 4513]}
rpweccdkaictrsnpptcrcvdevkkcaptcktclpsrsrpsrrvcidsyfgpvpprc

Sequence, based on observed residues (ATOM records):

>d1tx6i1 g.3.13.1 (I:64-122) Bowman-Birk inhibitor, BBI {Barley (Hordeum vulgare) [TaxId: 4513]}
rpweccdkaictrsnpptcrcvdevkkcaptcktclrvcidsyfgpvpprc

Timeline for d1tx6i1:

• d1tx6i1 first appeared in SCOP 1.73
  
• d1tx6i1 appears in SCOPe 2.01
  
• d1tx6i1 appears in the current release, SCOPe 2.08