![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
![]() | Protein Trypsin(ogen) [50515] (9 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [50517] (33 PDB entries) Uniprot P00761 9-231 ! Uniprot P00761 |
![]() | Domain d1tx6c_: 1tx6 C: [119377] Other proteins in same PDB: d1tx6i1, d1tx6j1 automated match to d1an1e_ complexed with ca |
PDB Entry: 1tx6 (more details), 2.2 Å
SCOPe Domain Sequences for d1tx6c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tx6c_ b.47.1.2 (C:) Trypsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} ivggytcaansipyqvslnsgshfcggslinsqwvvsaahcyksriqvrlgehnidvleg neqfinaakiithpnfngntldndimliklsspatlnsrvatvslprscaaagteclisg wgntkssgssypsllqclkapvlsdssckssypgqitgnmicvgfleggkdscqgdsggp vvcngqlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan
Timeline for d1tx6c_: