Lineage for d1twrb_ (1twr B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
    automatically mapped to Pfam PF01126
  6. Protein Heme oxygenase-1 (HO-1) [48615] (3 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [48616] (26 PDB entries)
    Uniprot P09601
  8. Domain d1twrb_: 1twr B: [119370]
    automated match to d1ni6c_
    complexed with no, ver

Details for d1twrb_

PDB Entry: 1twr (more details), 2.1 Å

PDB Description: Crystal structures of ferrous and ferrous-NO forms of verdoheme in a complex with human heme oxygenase-1: catalytic implications for heme cleavage
PDB Compounds: (B:) Heme oxygenase 1

SCOPe Domain Sequences for d1twrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twrb_ a.132.1.1 (B:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

SCOPe Domain Coordinates for d1twrb_ are not available.

Timeline for d1twrb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1twra_