![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) ![]() the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity |
![]() | Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins) automatically mapped to Pfam PF01395 |
![]() | Protein Moth pheromone-binding protein, PBP [47569] (2 species) |
![]() | Species Polyphemus moth (Antheraea polyphemus) [TaxId:7120] [101187] (3 PDB entries) |
![]() | Domain d1twoa_: 1two A: [119368] automated match to d2jpoa1 |
PDB Entry: 1two (more details)
SCOPe Domain Sequences for d1twoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1twoa_ a.39.2.1 (A:) Moth pheromone-binding protein, PBP {Polyphemus moth (Antheraea polyphemus) [TaxId: 7120]} speimknlsnnfgkamdqckdelslpdsvvadlynfwkddyvmtdrlagcainclatkld vvdpdgnlhhgnakdfamkhgadetmaqqlvdiihgceksappnddkcmktidvamcfkk eihklnwvpnmdlvigevlaev
Timeline for d1twoa_: