SCOPe 2.03: Domain d1twoa1: 1two A:1-142

Lineage for d1twoa1 (1two A:1-142)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
   automatically mapped to Pfam PF01395

6. Protein Moth pheromone-binding protein, PBP [47569] (2 species)

7. Species Polyphemus moth (Antheraea polyphemus) [TaxId:7120] [101187] (3 PDB entries)

8. Domain d1twoa1: 1two A:1-142 [119368]
   automatically matched to d1qwva_

Details for d1twoa1

PDB Entry: 1two

PDB Description: nmr structure of the pheromone binding protein from antheraea polyphemus at acidic ph

PDB Compounds: (A:) pheromone-binding protein

SCOPe Domain Sequences for d1twoa1:

Sequence; same for both SEQRES and ATOM records:

>d1twoa1 a.39.2.1 (A:1-142) Moth pheromone-binding protein, PBP {Polyphemus moth (Antheraea polyphemus) [TaxId: 7120]}
speimknlsnnfgkamdqckdelslpdsvvadlynfwkddyvmtdrlagcainclatkld
vvdpdgnlhhgnakdfamkhgadetmaqqlvdiihgceksappnddkcmktidvamcfkk
eihklnwvpnmdlvigevlaev

Timeline for d1twoa1:

• d1twoa1 first appeared in SCOP 1.73
  
• d1twoa1 appears in SCOPe 2.02
  
• d1twoa1 is called d1twoa_ in SCOPe 2.04
  
• d1twoa1 appears in the current release, SCOPe 2.08, called d1twoa_