Lineage for d1twoa1 (1two A:1-142)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768455Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 769304Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (1 family) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 769305Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (5 proteins)
  6. 769306Protein Moth pheromone-binding protein, PBP [47569] (2 species)
  7. 769307Species Polyphemus moth (Antheraea polyphemus) [TaxId:7120] [101187] (3 PDB entries)
  8. 769310Domain d1twoa1: 1two A:1-142 [119368]
    automatically matched to d1qwva_

Details for d1twoa1

PDB Entry: 1two (more details)

PDB Description: nmr structure of the pheromone binding protein from antheraea polyphemus at acidic ph
PDB Compounds: (A:) pheromone-binding protein

SCOP Domain Sequences for d1twoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twoa1 a.39.2.1 (A:1-142) Moth pheromone-binding protein, PBP {Polyphemus moth (Antheraea polyphemus) [TaxId: 7120]}
speimknlsnnfgkamdqckdelslpdsvvadlynfwkddyvmtdrlagcainclatkld
vvdpdgnlhhgnakdfamkhgadetmaqqlvdiihgceksappnddkcmktidvamcfkk
eihklnwvpnmdlvigevlaev

SCOP Domain Coordinates for d1twoa1:

Click to download the PDB-style file with coordinates for d1twoa1.
(The format of our PDB-style files is described here.)

Timeline for d1twoa1: