SCOPe 2.05: Domain d1twna_: 1twn A:

Lineage for d1twna_ (1twn A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
   automatically mapped to Pfam PF01126

6. Protein Heme oxygenase-1 (HO-1) [48615] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48616] (24 PDB entries)
   Uniprot P09601

8. Domain d1twna_: 1twn A: [119366]
   automated match to d1ni6c_
   complexed with ver

Details for d1twna_

PDB Entry: 1twn, 2.2 Å

PDB Description: crystal structures of ferrous and ferrous-no forms of verdoheme in a complex with human heme oxygenase-1: catalytic implications for heme cleavage

PDB Compounds: (A:) Heme oxygenase 1

SCOPe Domain Sequences for d1twna_:

Sequence; same for both SEQRES and ATOM records:

>d1twna_ a.132.1.1 (A:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

Timeline for d1twna_:

• d1twna_ first appeared in SCOP 1.73, called d1twna1
  
• d1twna_ appears in SCOPe 2.04
  
• d1twna_ appears in SCOPe 2.06
  
• d1twna_ appears in the current release, SCOPe 2.08