Lineage for d1tw0a1 (1tw0 A:1-147)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538746Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2539012Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2539013Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)
  6. 2539064Protein Plant pathogenesis-related protein PR10 [75543] (2 species)
  7. 2539065Species Jicama (Pachyrhizus erosus), SPE-16 [TaxId:109171] [143818] (1 PDB entry)
    Uniprot Q6T6J0 2-148
  8. 2539066Domain d1tw0a1: 1tw0 A:1-147 [119364]
    Other proteins in same PDB: d1tw0a2, d1tw0b2, d1tw0b3

Details for d1tw0a1

PDB Entry: 1tw0 (more details), 2.2 Å

PDB Description: Native crystal structure of SPE16
PDB Compounds: (A:) pathogenesis-related class 10 protein SPE-16

SCOPe Domain Sequences for d1tw0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tw0a1 d.129.3.1 (A:1-147) Plant pathogenesis-related protein PR10 {Jicama (Pachyrhizus erosus), SPE-16 [TaxId: 109171]}
gvfvfrdetsssvapaklykaltkdsdtiaqkidgpiqsielvegnggvgtikkitaneg
dktsfvlqkvdaideanlgydysivggtglpesleklsfetkvvagsgggsiskvtlkfh
tkgdaplsdavrddalakgagffkaie

SCOPe Domain Coordinates for d1tw0a1:

Click to download the PDB-style file with coordinates for d1tw0a1.
(The format of our PDB-style files is described here.)

Timeline for d1tw0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tw0a2