Lineage for d1tvpb_ (1tvp B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2830914Protein Endoglucanase Cel5a [51499] (4 species)
  7. 2830943Species Pseudoalteromonas haloplanktis [TaxId:228] [141773] (2 PDB entries)
    Uniprot O86099 33-325
  8. 2830947Domain d1tvpb_: 1tvp B: [119363]
    automated match to d1egza_
    complexed with epe

Details for d1tvpb_

PDB Entry: 1tvp (more details), 1.6 Å

PDB Description: endoglucanase cel5g from pseudoalteromonas haloplanktis in complex with cellobiose
PDB Compounds: (B:) cellulase

SCOPe Domain Sequences for d1tvpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tvpb_ c.1.8.3 (B:) Endoglucanase Cel5a {Pseudoalteromonas haloplanktis [TaxId: 228]}
avekltvsgnqilaggentsfagpslfwsntgwgaekfytaetvakaktefnatliraai
ghgtstggslnfdwegnmsrldtvvnaaiaedmyviidfhsheahtdqatavrffedvat
kygqydnviyeiyneplqiswvndikpyaetvidkiraidpdnlivvgtptwsqdvdvas
qnpidraniaytlhfyagthgqsyrnkaqtaldngialfatewgtvnadgnggvninetd
awmaffktnnishanwalndknegaslftpggswnsltssgskvkeiiqgw

SCOPe Domain Coordinates for d1tvpb_:

Click to download the PDB-style file with coordinates for d1tvpb_.
(The format of our PDB-style files is described here.)

Timeline for d1tvpb_: