Lineage for d1tvpa1 (1tvp A:1-293)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 682152Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 682589Family c.1.8.3: beta-glycanases [51487] (24 proteins)
    consist of a number of sequence families
  6. 682849Protein Endoglucanase Cel5a [51499] (4 species)
  7. 682876Species Pseudoalteromonas haloplanktis [TaxId:228] [141773] (2 PDB entries)
  8. 682879Domain d1tvpa1: 1tvp A:1-293 [119362]
    automatically matched to 1TVN A:1-293
    complexed with cbi, epe

Details for d1tvpa1

PDB Entry: 1tvp (more details), 1.6 Å

PDB Description: endoglucanase cel5g from pseudoalteromonas haloplanktis in complex with cellobiose
PDB Compounds: (A:) cellulase

SCOP Domain Sequences for d1tvpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tvpa1 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalteromonas haloplanktis [TaxId: 228]}
avekltvsgnqilaggentsfagpslfwsntgwgaekfytaetvakaktefnatliraai
ghgtstggslnfdwegnmsrldtvvnaaiaedmyviidfhsheahtdqatavrffedvat
kygqydnviyeiyneplqiswvndikpyaetvidkiraidpdnlivvgtptwsqdvdvas
qnpidraniaytlhfyagthgqsyrnkaqtaldngialfatewgtvnadgnggvninetd
awmaffktnnishanwalndknegaslftpggswnsltssgskvkeiiqgwgg

SCOP Domain Coordinates for d1tvpa1:

Click to download the PDB-style file with coordinates for d1tvpa1.
(The format of our PDB-style files is described here.)

Timeline for d1tvpa1: