SCOPe 2.06: Domain d1tvhd2: 1tvh D:1-181

Lineage for d1tvhd2 (1tvh D:1-181)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (101 PDB entries)
   Uniprot P01892 25-298

8. Domain d1tvhd2: 1tvh D:1-181 [119358]
   Other proteins in same PDB: d1tvha1, d1tvhb2, d1tvhb3, d1tvhd1, d1tvhe2, d1tvhe3
   automatically matched to d1akja2
   complexed with gol

Details for d1tvhd2

PDB Entry: 1tvh, 1.8 Å

PDB Description: crystal structure of modified melanoma antigen gp100(209-t2m) bound to human class i mhc hla-a2

PDB Compounds: (D:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d1tvhd2:

Sequence; same for both SEQRES and ATOM records:

>d1tvhd2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d1tvhd2:

• d1tvhd2 first appeared in SCOP 1.73
  
• d1tvhd2 appears in SCOPe 2.05
  
• d1tvhd2 appears in SCOPe 2.07
  
• d1tvhd2 appears in the current release, SCOPe 2.08