SCOP 1.73: Domain d1tvha1: 1tvh A:182-275

Lineage for d1tvha1 (1tvh A:182-275)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (130 PDB entries)

8. Domain d1tvha1: 1tvh A:182-275 [119354]
   Other proteins in same PDB: d1tvha2, d1tvhb1, d1tvhd2, d1tvhe1
   automatically matched to d1akja1
   complexed with gol

Details for d1tvha1

PDB Entry: 1tvh, 1.8 Å

PDB Description: crystal structure of modified melanoma antigen gp100(209-t2m) bound to human class i mhc hla-a2

PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOP Domain Sequences for d1tvha1:

Sequence; same for both SEQRES and ATOM records:

>d1tvha1 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

Timeline for d1tvha1:

• d1tvha1 is new in SCOP 1.73
  
• d1tvha1 appears in SCOP 1.75
  
• d1tvha1 appears in the current release, SCOPe 2.08