Lineage for d1tvba2 (1tvb A:1-181)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1198031Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 1198044Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (76 PDB entries)
    Uniprot P01892 25-298
  8. 1198064Domain d1tvba2: 1tvb A:1-181 [119349]
    Other proteins in same PDB: d1tvba1, d1tvbb_, d1tvbd1, d1tvbe_
    automatically matched to d1akja2
    complexed with gol

Details for d1tvba2

PDB Entry: 1tvb (more details), 1.8 Å

PDB Description: Crystal structure of Melanoma Antigen gp100(209-217) Bound to Human Class I MHC HLA-A2
PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d1tvba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tvba2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d1tvba2:

Click to download the PDB-style file with coordinates for d1tvba2.
(The format of our PDB-style files is described here.)

Timeline for d1tvba2: