Lineage for d1tv5a1 (1tv5 A:158-566)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 681629Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) (S)
  5. 681630Family c.1.4.1: FMN-linked oxidoreductases [51396] (18 proteins)
  6. 681670Protein Dihydroorotate dehydrogenase [51397] (7 species)
  7. 681712Species Plasmodium falciparum [TaxId:5833] [141759] (1 PDB entry)
    homolog, mitochonrial
  8. 681713Domain d1tv5a1: 1tv5 A:158-566 [119347]
    complexed with a26, fmn, n8e, oro, so4; mutant

Details for d1tv5a1

PDB Entry: 1tv5 (more details), 2.4 Å

PDB Description: Plasmodium falciparum dihydroorotate dehydrogenase with a bound inhibitor
PDB Compounds: (A:) Dihydroorotate dehydrogenase homolog, mitochondrial

SCOP Domain Sequences for d1tv5a1:

Sequence, based on SEQRES records: (download)

>d1tv5a1 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase {Plasmodium falciparum [TaxId: 5833]}
fesynpefflydiflkfclkyidgeichdlflllgkynilpydtsndsiyactnikhldf
inpfgvaagfdkngvcidsilklgfsfieigtitprgqtgnakprifrdvesrsiinscg
fnnmgcdkvtenlilfrkrqeedkllskhivgvsigknkdtvnivddlkycinkigryad
yiainvsspntpglrdnqeagklkniilsvkeeidnleknnimndestynednkivekkn
nfnknnshmmkdakdnflwfnttkkkplvfvklapdlnqeqkkeiadvlletnidgmiis
ntttqindiksfenkkggvsgaklkdistkficemynytnkqipiiasggifsgldalek
ieagasvcqlysclvfngmksavqikrelnhllyqrgyynlkeaigrkh

Sequence, based on observed residues (ATOM records): (download)

>d1tv5a1 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase {Plasmodium falciparum [TaxId: 5833]}
fesynpefflydiflkfclkyidgeichdlflllgkynilpydtsndsiyactnikhldf
inpfgvaagfdkngvcidsilklgfsfieigtitprgqtgnakprifrdvesrsiinscg
fnnmgcdkvtenlilfrkrqeedkllskhivgvsigknkdtvnivddlkycinkigryad
yiainvsspntpglrdnqeagklkniilsvkeeidnleflwfnttkkkplvfvklapdln
qeqkkeiadvlletnidgmiisntttqindiksfenkkggvsgaklkdistkficemyny
tnkqipiiasggifsgldalekieagasvcqlysclvfngmksavqikrelnhllyqrgy
ynlkeaigrkh

SCOP Domain Coordinates for d1tv5a1:

Click to download the PDB-style file with coordinates for d1tv5a1.
(The format of our PDB-style files is described here.)

Timeline for d1tv5a1: