SCOP 1.73: Domain d1tuua1: 1tuu A:1-197

Lineage for d1tuua1 (1tuu A:1-197)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families)
   duplication contains two domains of this fold

5. Family c.55.1.2: Acetokinase-like [53080] (3 proteins)

6. Protein Acetate kinase [53081] (1 species)

7. Species Archaeon Methanosarcina thermophila [TaxId:2210] [53082] (3 PDB entries)

8. Domain d1tuua1: 1tuu A:1-197 [119343]
   automatically matched to d1g99a1
   complexed with adp, amp, nh4, pis, so4

Details for d1tuua1

PDB Entry: 1tuu, 2.5 Å

PDB Description: acetate kinase crystallized with atpgs

PDB Compounds: (A:) acetate kinase

SCOP Domain Sequences for d1tuua1:

Sequence; same for both SEQRES and ATOM records:

>d1tuua1 c.55.1.2 (A:1-197) Acetate kinase {Archaeon Methanosarcina thermophila [TaxId: 2210]}
mkvlvinagssslkyqlidmtnesalavglcerigidnsiitqkkfdgkklekltdlpth
kdaleevvkaltddefgvikdmgeinavghrvvhggekfttsalydegvekaikdcfela
plhnppnmmgisacaeimpgtpmvivfdtafhqtmppyaymyalpydlyekhgvrkygfh
gtshkyvaeraalmlgk

Timeline for d1tuua1:

• d1tuua1 is new in SCOP 1.73
  
• d1tuua1 appears in SCOP 1.75
  
• d1tuua1 appears in the current release, SCOPe 2.08