![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily) 4 helices; folded leaf; right-handed superhelix |
![]() | Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) ![]() can be classified as disulfide-rich |
![]() | Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (4 proteins) |
![]() | Protein Non-specific lipid-transfer protein homologue (ns-LTP2) [81787] (3 species) different pattern for Cys-pairing compared with ns-LTP1 |
![]() | Species Wheat (Triticum aestivum) [TaxId:4565] [186777] (1 PDB entry) |
![]() | Domain d1tuka_: 1tuk A: [119342] automated match to d1n89a_ complexed with iod, pgm |
PDB Entry: 1tuk (more details), 1.12 Å
SCOPe Domain Sequences for d1tuka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tuka_ a.52.1.1 (A:) Non-specific lipid-transfer protein homologue (ns-LTP2) {Wheat (Triticum aestivum) [TaxId: 4565]} acqasqlavcasailsgakpsgeccgnlraqqgcfcqyakdptygqyirsphardtltsc glavphc
Timeline for d1tuka_: