Lineage for d1tuka_ (1tuk A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998158Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
    4 helices; folded leaf; right-handed superhelix
  4. 1998159Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) (S)
    can be classified as disulfide-rich
  5. 1998160Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (4 protein domains)
  6. 1998161Protein Non-specific lipid-transfer protein homologue (ns-LTP2) [81787] (3 species)
    different pattern for Cys-pairing compared with ns-LTP1
  7. 1998166Species Wheat (Triticum aestivum) [TaxId:4565] [186777] (1 PDB entry)
  8. 1998167Domain d1tuka_: 1tuk A: [119342]
    automated match to d1n89a_
    complexed with iod, pgm

Details for d1tuka_

PDB Entry: 1tuk (more details), 1.12 Å

PDB Description: Crystal stucture of liganted type 2 non specific lipid transfer protein from wheat
PDB Compounds: (A:) Nonspecific lipid-transfer protein 2G

SCOPe Domain Sequences for d1tuka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tuka_ a.52.1.1 (A:) Non-specific lipid-transfer protein homologue (ns-LTP2) {Wheat (Triticum aestivum) [TaxId: 4565]}
acqasqlavcasailsgakpsgeccgnlraqqgcfcqyakdptygqyirsphardtltsc
glavphc

SCOPe Domain Coordinates for d1tuka_:

Click to download the PDB-style file with coordinates for d1tuka_.
(The format of our PDB-style files is described here.)

Timeline for d1tuka_: