SCOP 1.73: Domain d1tu2a1: 1tu2 A:1-105

Lineage for d1tu2a1 (1tu2 A:1-105)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (7 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (9 proteins)
   mono-domain proteins

6. Protein Plastocyanin [49507] (14 species)

7. Species Anabaena variabilis [TaxId:1172] [49517] (5 PDB entries)

8. Domain d1tu2a1: 1tu2 A:1-105 [119341]
   automatically matched to d1fa4a_
   complexed with cu, hec

Details for d1tu2a1

PDB Entry: 1tu2

PDB Description: the complex of nostoc cytochrome f and plastocyanin determin with paramagnetic nmr. based on the structures of cytochrome f and plastocyanin, 10 structures

PDB Compounds: (A:) plastocyanin

SCOP Domain Sequences for d1tu2a1:

Sequence; same for both SEQRES and ATOM records:

>d1tu2a1 b.6.1.1 (A:1-105) Plastocyanin {Anabaena variabilis [TaxId: 1172]}
etytvklgsdkgllvfepakltikpgdtveflnnkvpphnvvfdaalnpaksadlaksls
hkqllmspgqststtfpadapageytfycephrgagmvgkitvag

Timeline for d1tu2a1:

• d1tu2a1 is new in SCOP 1.73
  
• d1tu2a1 appears in SCOP 1.75
  
• d1tu2a1 appears in the current release, SCOPe 2.08