![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
![]() | Protein Plastocyanin [49507] (17 species) |
![]() | Species Anabaena variabilis [TaxId:1172] [49517] (4 PDB entries) |
![]() | Domain d1tu2a1: 1tu2 A:1-105 [119341] Other proteins in same PDB: d1tu2b1, d1tu2b2 automatically matched to d1fa4a_ complexed with cu, hec |
PDB Entry: 1tu2 (more details)
SCOPe Domain Sequences for d1tu2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tu2a1 b.6.1.1 (A:1-105) Plastocyanin {Anabaena variabilis [TaxId: 1172]} etytvklgsdkgllvfepakltikpgdtveflnnkvpphnvvfdaalnpaksadlaksls hkqllmspgqststtfpadapageytfycephrgagmvgkitvag
Timeline for d1tu2a1: