Lineage for d1ttna1 (1ttn A:21-100)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717081Superfamily d.15.1: Ubiquitin-like [54236] (7 families) (S)
  5. 717082Family d.15.1.1: Ubiquitin-related [54237] (38 protein domains)
    Pfam PF00240
  6. 717098Protein Dendritic cell-derived ubiquitin-like protein [142954] (1 species)
  7. 717099Species Human (Homo sapiens) [TaxId:9606] [142955] (1 PDB entry)
  8. 717100Domain d1ttna1: 1ttn A:21-100 [119340]

Details for d1ttna1

PDB Entry: 1ttn (more details)

PDB Description: Solution structure of the ubiquitin-like domain of human DC-UBP from dendritic cells
PDB Compounds: (A:) dendritic cell-derived ubiquitin-like protein

SCOP Domain Sequences for d1ttna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]}
gyecqlrlrlstgkdlklvvrstdtvfhmkrrlhaaegvepgsqrwffsgrpltdkmkfe
elkipkdyvvqvivsqpvqn

SCOP Domain Coordinates for d1ttna1:

Click to download the PDB-style file with coordinates for d1ttna1.
(The format of our PDB-style files is described here.)

Timeline for d1ttna1: