SCOPe 2.08: Domain d1tsub1: 1tsu B:1-99

Lineage for d1tsub1 (1tsu B:1-99)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (9 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (590 PDB entries)
   Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167

8. Domain d1tsub1: 1tsu B:1-99 [119337]
   automatically matched to d1f7aa_

Details for d1tsub1

PDB Entry: 1tsu, 2.1 Å

PDB Description: crystal structure of decamer ncp1 substrate peptide in complex with wild-type d25n hiv-1 protease variant

PDB Compounds: (B:) Pol polyprotein

SCOPe Domain Sequences for d1tsub1:

Sequence; same for both SEQRES and ATOM records:

>d1tsub1 b.50.1.1 (B:1-99) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d1tsub1:

• d1tsub1 first appeared in SCOP 1.73
  
• d1tsub1 appears in SCOPe 2.07