SCOPe 2.08: Domain d1tsqa1: 1tsq A:1-99

Lineage for d1tsqa1 (1tsq A:1-99)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (9 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (590 PDB entries)
   Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167

8. Domain d1tsqa1: 1tsq A:1-99 [119334]
   automatically matched to d1mt7a_
   complexed with act; mutant

Details for d1tsqa1

PDB Entry: 1tsq, 2 Å

PDB Description: crystal structure of ap2v substrate variant of nc-p1 decamer peptide in complex with v82a/d25n hiv-1 protease mutant

PDB Compounds: (A:) Pol polyprotein

SCOPe Domain Sequences for d1tsqa1:

Sequence; same for both SEQRES and ATOM records:

>d1tsqa1 b.50.1.1 (A:1-99) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpaniigrnlltqigctlnf

Timeline for d1tsqa1:

• d1tsqa1 first appeared in SCOP 1.73
  
• d1tsqa1 appears in SCOPe 2.07