Lineage for d1ts8a1 (1ts8 A:1-125)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 731578Fold d.110: Profilin-like [55769] (9 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 731664Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (6 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 731665Family d.110.3.1: PYP-like [55786] (2 proteins)
  6. 731666Protein Photoactive yellow protein, PYP [55787] (1 species)
  7. 731667Species Ectothiorhodospira halophila [TaxId:17] [55788] (40 PDB entries)
  8. 731703Domain d1ts8a1: 1ts8 A:1-125 [119333]
    automatically matched to d1nwza_
    complexed with hc4

Details for d1ts8a1

PDB Entry: 1ts8 (more details), 1.6 Å

PDB Description: structure of the pr cis planar intermediate from time-resolved laue crystallography
PDB Compounds: (A:) Photoactive yellow protein

SCOP Domain Sequences for d1ts8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ts8a1 d.110.3.1 (A:1-125) Photoactive yellow protein, PYP {Ectothiorhodospira halophila [TaxId: 1053]}
mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
fvkrv

SCOP Domain Coordinates for d1ts8a1:

Click to download the PDB-style file with coordinates for d1ts8a1.
(The format of our PDB-style files is described here.)

Timeline for d1ts8a1: