Lineage for d1ts8a_ (1ts8 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2534513Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2534777Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2534778Family d.110.3.1: PYP-like [55786] (3 proteins)
  6. 2534779Protein Photoactive yellow protein, PYP [55787] (1 species)
  7. 2534780Species Methylophilus methylotrophus, strain w3a1 [TaxId:17] [55788] (82 PDB entries)
    Uniprot P16113
  8. 2534822Domain d1ts8a_: 1ts8 A: [119333]
    automated match to d1nwza_
    complexed with hc4

Details for d1ts8a_

PDB Entry: 1ts8 (more details), 1.6 Å

PDB Description: structure of the pr cis planar intermediate from time-resolved laue crystallography
PDB Compounds: (A:) Photoactive yellow protein

SCOPe Domain Sequences for d1ts8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ts8a_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Methylophilus methylotrophus, strain w3a1 [TaxId: 17]}
mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
fvkrv

SCOPe Domain Coordinates for d1ts8a_:

Click to download the PDB-style file with coordinates for d1ts8a_.
(The format of our PDB-style files is described here.)

Timeline for d1ts8a_: