SCOP 1.75: Domain d1ts0a1: 1ts0 A:1-125

Lineage for d1ts0a1 (1ts0 A:1-125)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (7 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.1: PYP-like [55786] (2 proteins)

6. Protein Photoactive yellow protein, PYP [55787] (1 species)

7. Species Ectothiorhodospira halophila [TaxId:17] [55788] (43 PDB entries)
   Uniprot P16113

8. Domain d1ts0a1: 1ts0 A:1-125 [119330]
   automatically matched to d1nwza_
   complexed with hc4

Details for d1ts0a1

PDB Entry: 1ts0, 1.6 Å

PDB Description: structure of the pb1 intermediate from time-resolved laue crystallography

PDB Compounds: (A:) Photoactive yellow protein

SCOP Domain Sequences for d1ts0a1:

Sequence; same for both SEQRES and ATOM records:

>d1ts0a1 d.110.3.1 (A:1-125) Photoactive yellow protein, PYP {Ectothiorhodospira halophila [TaxId: 1053]}
mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
fvkrv

Timeline for d1ts0a1:

• d1ts0a1 first appeared in SCOP 1.73
  
• d1ts0a1 is called d1ts0a_ in SCOPe 2.01
  
• d1ts0a1 appears in the current release, SCOPe 2.08, called d1ts0a_