SCOPe 2.08: Domain d1tr7b_: 1tr7 B:

Lineage for d1tr7b_ (1tr7 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (11 proteins)

6. Protein automated matches [190569] (9 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [188033] (6 PDB entries)

8. Domain d1tr7b_: 1tr7 B: [119329]
   automated match to d1uwfa1
   complexed with cac, deg, mpd

Details for d1tr7b_

PDB Entry: 1tr7, 2.1 Å

PDB Description: fimh adhesin receptor binding domain from uropathogenic e. coli

PDB Compounds: (B:) FimH PROTEIN

SCOPe Domain Sequences for d1tr7b_:

Sequence; same for both SEQRES and ATOM records:

>d1tr7b_ b.2.3.2 (B:) automated matches {Escherichia coli [TaxId: 562]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

Timeline for d1tr7b_:

• d1tr7b_ first appeared in SCOP 1.73, called d1tr7b1
  
• d1tr7b_ appears in SCOPe 2.07