Lineage for d1tr7b_ (1tr7 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767438Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2767443Family b.2.3.2: Pilus subunits [49405] (11 proteins)
  6. 2767660Protein automated matches [190569] (9 species)
    not a true protein
  7. 2767677Species Escherichia coli [TaxId:562] [188033] (6 PDB entries)
  8. 2767683Domain d1tr7b_: 1tr7 B: [119329]
    automated match to d1uwfa1
    complexed with cac, deg, mpd

Details for d1tr7b_

PDB Entry: 1tr7 (more details), 2.1 Å

PDB Description: fimh adhesin receptor binding domain from uropathogenic e. coli
PDB Compounds: (B:) FimH PROTEIN

SCOPe Domain Sequences for d1tr7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tr7b_ b.2.3.2 (B:) automated matches {Escherichia coli [TaxId: 562]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

SCOPe Domain Coordinates for d1tr7b_:

Click to download the PDB-style file with coordinates for d1tr7b_.
(The format of our PDB-style files is described here.)

Timeline for d1tr7b_: