Lineage for d1tr7a_ (1tr7 A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1112569Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1112704Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 1112709Family b.2.3.2: Pilus subunits [49405] (9 proteins)
  6. 1112822Protein automated matches [190569] (5 species)
    not a true protein
  7. 1112823Species Escherichia coli [TaxId:562] [188033] (3 PDB entries)
  8. 1112824Domain d1tr7a_: 1tr7 A: [119328]
    automated match to d1uwfa1
    complexed with cac, deg, mpd

Details for d1tr7a_

PDB Entry: 1tr7 (more details), 2.1 Å

PDB Description: fimh adhesin receptor binding domain from uropathogenic e. coli
PDB Compounds: (A:) FimH PROTEIN

SCOPe Domain Sequences for d1tr7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tr7a_ b.2.3.2 (A:) automated matches {Escherichia coli [TaxId: 562]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

SCOPe Domain Coordinates for d1tr7a_:

Click to download the PDB-style file with coordinates for d1tr7a_.
(The format of our PDB-style files is described here.)

Timeline for d1tr7a_: