Class b: All beta proteins [48724] (174 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) |
Family b.2.3.2: Pilus subunits [49405] (9 proteins) |
Protein automated matches [190569] (5 species) not a true protein |
Species Escherichia coli [TaxId:562] [188033] (3 PDB entries) |
Domain d1tr7a_: 1tr7 A: [119328] automated match to d1uwfa1 complexed with cac, deg, mpd |
PDB Entry: 1tr7 (more details), 2.1 Å
SCOPe Domain Sequences for d1tr7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tr7a_ b.2.3.2 (A:) automated matches {Escherichia coli [TaxId: 562]} facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai kagsliavlilrqtnnynsddfqfvwniyanndvvvpt
Timeline for d1tr7a_: