Lineage for d1tr7a1 (1tr7 A:1-158)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 659309Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 659391Superfamily b.2.3: Bacterial adhesins [49401] (6 families) (S)
  5. 659396Family b.2.3.2: Pilus subunits [49405] (5 proteins)
  6. 659402Protein Mannose-specific adhesin FimH [49406] (1 species)
    duplication: consists of two domains of this fold; C-terminal domain lacks the last strand
  7. 659403Species Escherichia coli [TaxId:562] [49407] (6 PDB entries)
  8. 659406Domain d1tr7a1: 1tr7 A:1-158 [119328]
    automatically matched to d1klfb1
    complexed with cac, deg, mpd

Details for d1tr7a1

PDB Entry: 1tr7 (more details), 2.1 Å

PDB Description: fimh adhesin receptor binding domain from uropathogenic e. coli
PDB Compounds: (A:) FimH PROTEIN

SCOP Domain Sequences for d1tr7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tr7a1 b.2.3.2 (A:1-158) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 562]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

SCOP Domain Coordinates for d1tr7a1:

Click to download the PDB-style file with coordinates for d1tr7a1.
(The format of our PDB-style files is described here.)

Timeline for d1tr7a1: