Lineage for d1tqza1 (1tqz A:1-133)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 805150Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 805151Superfamily b.55.1: PH domain-like [50729] (13 families) (S)
  5. 805630Family b.55.1.11: Necap1 N-terminal domain-like [141439] (1 protein)
    Pfam PF07933; DUF1681
  6. 805631Protein Necap1 [141440] (1 species)
  7. 805632Species Mouse (Mus musculus) [TaxId:10090] [141441] (1 PDB entry)
    Uniprot Q9CR95 1-133
  8. 805633Domain d1tqza1: 1tqz A:1-133 [119327]

Details for d1tqza1

PDB Entry: 1tqz (more details)

PDB Description: solution structure of necap1 protein
PDB Compounds: (A:) necap1

SCOP Domain Sequences for d1tqza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tqza1 b.55.1.11 (A:1-133) Necap1 {Mouse (Mus musculus) [TaxId: 10090]}
maaeleyesvlcvkpdvsvyripprasnrgyrasdwkldqpdwtgrlritskgkiayikl
edkvsgelfaqapveqypgiavetvtdssryfviriqdgtgrsafigigftdrgdafdfn
vslqdhfkwvkqe

SCOP Domain Coordinates for d1tqza1:

Click to download the PDB-style file with coordinates for d1tqza1.
(The format of our PDB-style files is described here.)

Timeline for d1tqza1: