Lineage for d1tqva2 (1tqv A:523-1044)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 795365Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 795492Superfamily b.30.5: Galactose mutarotase-like [74650] (11 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 795762Family b.30.5.6: alpha-mannosidase, C-terminal domain [88656] (2 proteins)
    family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family
    the supersandwich domain is elaborated with additional beta-strands and beta-sandwich subdomains
  6. 795763Protein Golgi alpha-mannosidase II [88657] (1 species)
  7. 795764Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88658] (46 PDB entries)
    Uniprot Q24451 94-1107
  8. 795809Domain d1tqva2: 1tqv A:523-1044 [119322]
    Other proteins in same PDB: d1tqva1, d1tqva3
    automatically matched to d1htya2
    complexed with mrd, ndg, sse, zn; mutant

Details for d1tqva2

PDB Entry: 1tqv (more details), 2.03 Å

PDB Description: golgi alpha-mannosidase ii in complex with seleno-salacinol (blintol)
PDB Compounds: (A:) Alpha-mannosidase II

SCOP Domain Sequences for d1tqva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tqva2 b.30.5.6 (A:523-1044) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
yftlddsrwpgsgvedsrttiilgedilpskhvvmhntlphwreqlvdfyvsspfvsvtd
lannpveaqvspvwswhhdtltktihpqgsttkyriifkarvppmglatyvltisdskpe
htsyasnlllrknptslplgqypedvkfgdpreislrvgngptlafseqgllksiqltqd
sphvpvhfkflkygvrshgdrsgaylflpngpaspvelgqpvvlvtkgklessvsvglps
vvhqtimrggapeirnlvdigsldnteivmrlethidsgdifytdlnglqfikrrrldkl
plqanyypipsgmfiedantrltlltgqplggsslasgeleimqdrrlasdderglgqgv
ldnkpvlhiyrlvlekvnncvrpsklhpagyltsaahkasqslldpldkfifaenewiga
qgqfggdhpsaredldvsvmrrltkssaktqrvgyvlhrtnlmqcgtpeehtqkldvchl
lpnvarcerttltflqnlehldgmvapevcpmetaayvsshs

SCOP Domain Coordinates for d1tqva2:

Click to download the PDB-style file with coordinates for d1tqva2.
(The format of our PDB-style files is described here.)

Timeline for d1tqva2: