Class a: All alpha proteins [46456] (284 folds) |
Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
Superfamily a.8.3: Families 57/38 glycoside transferase middle domain [88688] (3 families) |
Family a.8.3.1: alpha-mannosidase, domain 2 [88693] (2 proteins) family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family |
Protein Golgi alpha-mannosidase II [88694] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88695] (46 PDB entries) Uniprot Q24451 94-1107 |
Domain d1tqva1: 1tqv A:412-522 [119321] Other proteins in same PDB: d1tqva2, d1tqva3 automatically matched to d1htya1 complexed with mrd, ndg, sse, zn; mutant |
PDB Entry: 1tqv (more details), 2.03 Å
SCOP Domain Sequences for d1tqva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tqva1 a.8.3.1 (A:412-522) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} dnywsgyytsrpyhkrmdrvlmhyvraaemlsawhswdgmarieerleqarrelslfqhh dgitgtakthvvvdyeqrmqealkacqmvmqqsvyrlltkpsiyspdfsfs
Timeline for d1tqva1: