SCOPe 2.01: Domain d1tqua1: 1tqu A:412-522

Lineage for d1tqua1 (1tqu A:412-522)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.3: Families 57/38 glycoside transferase middle domain [88688] (3 families)

5. Family a.8.3.1: alpha-mannosidase, domain 2 [88693] (2 proteins)
   family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family

6. Protein Golgi alpha-mannosidase II [88694] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88695] (46 PDB entries)
   Uniprot Q24451 94-1107

8. Domain d1tqua1: 1tqu A:412-522 [119318]
   Other proteins in same PDB: d1tqua2, d1tqua3
   automatically matched to d1htya1
   complexed with gha, mrd, ndg, zn

Details for d1tqua1

PDB Entry: 1tqu, 2.03 Å

PDB Description: golgi alpha-mannosidase ii in complex with the salacinol analog ghavamiol

PDB Compounds: (A:) Alpha-mannosidase II

SCOPe Domain Sequences for d1tqua1:

Sequence; same for both SEQRES and ATOM records:

>d1tqua1 a.8.3.1 (A:412-522) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dnywsgyytsrpyhkrmdrvlmhyvraaemlsawhswdgmarieerleqarrelslfqhh
dgitgtakthvvvdyeqrmqealkacqmvmqqsvyrlltkpsiyspdfsfs

Timeline for d1tqua1:

• d1tqua1 first appeared in SCOP 1.73
  
• d1tqua1 appears in SCOP 1.75
  
• d1tqua1 appears in SCOPe 2.02
  
• d1tqua1 appears in the current release, SCOPe 2.08