Lineage for d1tqua1 (1tqu A:412-522)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. Superfamily a.8.3: Families 57/38 glycoside transferase middle domain [88688] (4 families) (S)
  5. Family a.8.3.1: alpha-mannosidase, domain 2 [88693] (2 proteins)
    family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family
  6. Protein Golgi alpha-mannosidase II [88694] (1 species)
  7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88695] (57 PDB entries)
    Uniprot Q24451 94-1107
  8. Domain d1tqua1: 1tqu A:412-522 [119318]
    Other proteins in same PDB: d1tqua2, d1tqua3
    automated match to d1qwna1
    complexed with gha, mrd, nag, zn

Details for d1tqua1

PDB Entry: 1tqu (more details), 2.03 Å

PDB Description: golgi alpha-mannosidase ii in complex with the salacinol analog ghavamiol
PDB Compounds: (A:) Alpha-mannosidase II

SCOPe Domain Sequences for d1tqua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tqua1 a.8.3.1 (A:412-522) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dnywsgyytsrpyhkrmdrvlmhyvraaemlsawhswdgmarieerleqarrelslfqhh
dgitgtakthvvvdyeqrmqealkacqmvmqqsvyrlltkpsiyspdfsfs

SCOPe Domain Coordinates for d1tqua1 are not available.

Timeline for d1tqua1:

Domains from same chain:
(mouse over for more information)
d1tqua2, d1tqua3