| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
Superfamily a.8.3: Families 57/38 glycoside transferase middle domain [88688] (4 families) ![]() |
| Family a.8.3.1: alpha-mannosidase, domain 2 [88693] (2 proteins) family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family |
| Protein Golgi alpha-mannosidase II [88694] (1 species) |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88695] (57 PDB entries) Uniprot Q24451 94-1107 |
| Domain d1tqua1: 1tqu A:412-522 [119318] Other proteins in same PDB: d1tqua2, d1tqua3 automated match to d1qwna1 complexed with gha, mrd, nag, zn |
PDB Entry: 1tqu (more details), 2.03 Å
SCOPe Domain Sequences for d1tqua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tqua1 a.8.3.1 (A:412-522) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dnywsgyytsrpyhkrmdrvlmhyvraaemlsawhswdgmarieerleqarrelslfqhh
dgitgtakthvvvdyeqrmqealkacqmvmqqsvyrlltkpsiyspdfsfs
Timeline for d1tqua1: