SCOP 1.73: Domain d1tqta1: 1tqt A:412-522

Lineage for d1tqta1 (1tqt A:412-522)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (10 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.3: Families 57/38 glycoside transferase middle domain [88688] (3 families)

5. Family a.8.3.1: alpha-mannosidase, domain 2 [88693] (2 proteins)
   family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family

6. Protein Golgi alpha-mannosidase II [88694] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88695] (23 PDB entries)

8. Domain d1tqta1: 1tqt A:412-522 [119315]
   Other proteins in same PDB: d1tqta2, d1tqta3
   automatically matched to d1htya1
   complexed with mrd, nag, ssd, zn; mutant

Details for d1tqta1

PDB Entry: 1tqt, 1.9 Å

PDB Description: golgi alpha-mannosidase ii in complex with a diastereomer of salacinol

PDB Compounds: (A:) Alpha-mannosidase II

SCOP Domain Sequences for d1tqta1:

Sequence; same for both SEQRES and ATOM records:

>d1tqta1 a.8.3.1 (A:412-522) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dnywsgyytsrpyhkrmdrvlmhyvraaemlsawhswdgmarieerleqarrelslfqhh
dgitgtakthvvvdyeqrmqealkacqmvmqqsvyrlltkpsiyspdfsfs

Timeline for d1tqta1:

• d1tqta1 is new in SCOP 1.73
  
• d1tqta1 appears in SCOP 1.75
  
• d1tqta1 appears in the current release, SCOPe 2.08