SCOP 1.75: Domain d1tq3a1: 1tq3 A:306-403

Lineage for d1tq3a1 (1tq3 A:306-403)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (6 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (46 proteins)
   Pfam PF00595

6. Protein Synaptic protein PSD-95 [50162] (2 species)
   Synonym: synapse associated protein 90, sap90
   duplication: contains three PDZ domains

7. Species Rat (Rattus norvegicus) [TaxId:10116] [50163] (9 PDB entries)
   Uniprot P31016 62-154

8. Domain d1tq3a1: 1tq3 A:306-403 [119310]
   automatically matched to 1TP3 A:302-403

Details for d1tq3a1

PDB Entry: 1tq3, 1.89 Å

PDB Description: higher resolution crystal structure of the third pdz domain of post synaptic psd-95 protein

PDB Compounds: (A:) Presynaptic density protein 95

SCOP Domain Sequences for d1tq3a1:

Sequence; same for both SEQRES and ATOM records:

>d1tq3a1 b.36.1.1 (A:306-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]}
dipreprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkgdqilsvngv
dlrnasheqaaialknagqtvtiiaqykpeeysrfean

Timeline for d1tq3a1:

• d1tq3a1 first appeared in SCOP 1.73
  
• d1tq3a1 is called d1tq3a_ in SCOPe 2.01
  
• d1tq3a1 appears in the current release, SCOPe 2.08, called d1tq3a2