Lineage for d1tq3a1 (1tq3 A:306-403)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 666573Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 666574Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
    peptide-binding domain
  5. 666575Family b.36.1.1: PDZ domain [50157] (46 proteins)
    Pfam PF00595
  6. 666765Protein Synaptic protein PSD-95 [50162] (2 species)
    Synonym: synapse associated protein 90, sap90
    duplication: contains three PDZ domains
  7. 666768Species Rat (Rattus norvegicus) [TaxId:10116] [50163] (9 PDB entries)
  8. 666772Domain d1tq3a1: 1tq3 A:306-403 [119310]
    automatically matched to 1TP3 A:302-403

Details for d1tq3a1

PDB Entry: 1tq3 (more details), 1.89 Å

PDB Description: higher resolution crystal structure of the third pdz domain of post synaptic psd-95 protein
PDB Compounds: (A:) Presynaptic density protein 95

SCOP Domain Sequences for d1tq3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tq3a1 b.36.1.1 (A:306-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]}
dipreprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkgdqilsvngv
dlrnasheqaaialknagqtvtiiaqykpeeysrfean

SCOP Domain Coordinates for d1tq3a1:

Click to download the PDB-style file with coordinates for d1tq3a1.
(The format of our PDB-style files is described here.)

Timeline for d1tq3a1: