SCOPe 2.08: Domain d1tq3a2: 1tq3 A:306-402

Lineage for d1tq3a2 (1tq3 A:306-402)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Synaptic protein PSD-95 [50162] (2 species)
   Synonym: synapse associated protein 90, sap90
   duplication: contains three PDZ domains

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [50163] (14 PDB entries)
   Uniprot P31016 62-154

8. Domain d1tq3a2: 1tq3 A:306-402 [119310]
   Other proteins in same PDB: d1tq3a3
   automated match to d1be9a_

Details for d1tq3a2

PDB Entry: 1tq3, 1.89 Å

PDB Description: higher resolution crystal structure of the third pdz domain of post synaptic psd-95 protein

PDB Compounds: (A:) Presynaptic density protein 95

SCOPe Domain Sequences for d1tq3a2:

Sequence; same for both SEQRES and ATOM records:

>d1tq3a2 b.36.1.1 (A:306-402) Synaptic protein PSD-95 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dipreprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkgdqilsvngv
dlrnasheqaaialknagqtvtiiaqykpeeysrfea

Timeline for d1tq3a2:

• d1tq3a2 first appeared in SCOP 1.73, called d1tq3a1
  
• d1tq3a2 appears in SCOPe 2.07