Lineage for d1tp9b1 (1tp9 B:1-162)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 699806Family c.47.1.10: Glutathione peroxidase-like [52901] (28 proteins)
  6. 699980Protein Plant peroxiredoxin [142379] (1 species)
  7. 699981Species Western balsam poplar(Populus trichocarpa) [TaxId:3694] [142380] (1 PDB entry)
  8. 699983Domain d1tp9b1: 1tp9 B:1-162 [119307]
    automatically matched to 1TP9 A:1-162
    complexed with so4

Details for d1tp9b1

PDB Entry: 1tp9 (more details), 1.62 Å

PDB Description: PRX D (type II) from Populus tremula
PDB Compounds: (B:) peroxiredoxin

SCOP Domain Sequences for d1tp9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tp9b1 c.47.1.10 (B:1-162) Plant peroxiredoxin {Western balsam poplar(Populus trichocarpa) [TaxId: 3694]}
mapiavgdvlpdgklayfdeqdqlqevsvhslvagkkvilfgvpgaftptcslkhvpgfi
ekagelkskgvteilcisvndpfvmkawaksypenkhvkfladgsatythalgleldlqe
kglgtrsrrfallvddlkvkaaniegggeftvssaedilkdl

SCOP Domain Coordinates for d1tp9b1:

Click to download the PDB-style file with coordinates for d1tp9b1.
(The format of our PDB-style files is described here.)

Timeline for d1tp9b1: