![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (22 families) ![]() |
![]() | Family c.47.1.10: Glutathione peroxidase-like [52901] (28 proteins) |
![]() | Protein Plant peroxiredoxin [142379] (1 species) |
![]() | Species Western balsam poplar(Populus trichocarpa) [TaxId:3694] [142380] (1 PDB entry) |
![]() | Domain d1tp9b1: 1tp9 B:1-162 [119307] automatically matched to 1TP9 A:1-162 complexed with so4 |
PDB Entry: 1tp9 (more details), 1.62 Å
SCOP Domain Sequences for d1tp9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tp9b1 c.47.1.10 (B:1-162) Plant peroxiredoxin {Western balsam poplar(Populus trichocarpa) [TaxId: 3694]} mapiavgdvlpdgklayfdeqdqlqevsvhslvagkkvilfgvpgaftptcslkhvpgfi ekagelkskgvteilcisvndpfvmkawaksypenkhvkfladgsatythalgleldlqe kglgtrsrrfallvddlkvkaaniegggeftvssaedilkdl
Timeline for d1tp9b1: