SCOPe 2.06: Domain d1tp5a2: 1tp5 A:302-402

Lineage for d1tp5a2 (1tp5 A:302-402)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein automated matches [190055] (7 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [186775] (11 PDB entries)

8. Domain d1tp5a2: 1tp5 A:302-402 [119305]
   Other proteins in same PDB: d1tp5a3, d1tp5a4
   automated match to d1be9a_

Details for d1tp5a2

PDB Entry: 1tp5, 1.54 Å

PDB Description: crystal structure of pdz3 domain of psd-95 protein complexed with a peptide ligand kketwv

PDB Compounds: (A:) Presynaptic density protein 95

SCOPe Domain Sequences for d1tp5a2:

Sequence; same for both SEQRES and ATOM records:

>d1tp5a2 b.36.1.1 (A:302-402) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lgeedipreprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkgdqils
vngvdlrnasheqaaialknagqtvtiiaqykpeeysrfea

Timeline for d1tp5a2:

• d1tp5a2 first appeared in SCOP 1.73, called d1tp5a1
  
• d1tp5a2 was called d1tp5a_ in SCOPe 2.05
  
• d1tp5a2 appears in SCOPe 2.07
  
• d1tp5a2 appears in the current release, SCOPe 2.08